Anti-ACTH，促肾上腺皮质激素(1-39)抗体

• Product nameAnti-ACTH antibodySee all ACTH primary antibodies ...
• Description
  Rabbit polyclonal to ACTH
• Tested applicationsIHC-P, IHC-Fr, WB, IP more details
• Species reactivity
  Reacts with: Mouse, Rat, Human
  Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque Monkey, Orangutan
• Immunogen

  Synthetic peptide: sysmehfrwgkpvgkkrrpvkvypngaedesaeafplef, corresponding to amino acids 138-176 of human POMC （1-39 ACTH）. The peptide was covalently modified to achieve the desired antigenicity before coupling to carrier protein.

  Run BLAST with Run BLAST with

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. Upon delivery aliquot ａnd store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Storage bufferPreservative: 0.02% Sodium Azide
  
• Concentration100 µg at 0.68 mg/ml
  
• PurityProtein A purified
• ClonalityPolyclonal
• IsotypeIgG
• Research Areas
  • Neuroscience
  • Neurotransmitter
  • Neuropeptides
  • Hormones

  • Signal Transduction
  • Growth Factors/Hormones
  • Hormones

  • Neuroscience
  • Endocrine system
  • Hypothalamic pituitary adrenal axis

  • Cancer
  • Tumor biomarkers
  • Hormones

  • Cancer
  • Cancer Metabolism
  • Metabolic signaling pathway
  • Hormone biosynthesis

  • Metabolism
  • Pathways ａnd Processes
  • Endocrine metabolism
  • Hormone biosynthesis

  • Metabolism
  • Types of disease
  • Obesity

  • Metabolism
  • Types of disease
  • Cancer

Applications

Target

• RelevanceACTH occurs in cells of the anterior pituitary ａnd in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin ａnd Met enkephalin are endogenous opiates. MSH （melanocyte stimulating hormone） increases the pigmentation of skin by increasing melanin production in melanocytes.
• Cellular localizationSecreted
• Database links
  • Entrez Gene: 5443 Human
  • Entrez Gene: 694430 Macaque Monkey
  • Entrez Gene: 18976 Mouse
  • Entrez Gene: 24664 Rat
  • Omim: 176830 Human
  • SwissProt: P01190 Cow
  • SwissProt: P01189 Human
  • SwissProt: P01193 Mouse

  see all
• Alternative names
  • ACTH antibody
  • Adrenocorticotropic hormone antibody
  • Adrenocorticotropin antibody

  see all

Anti-ACTH antibody images

• 

  Immunohistochemistry （Formalin/PFA-fixed paraffin-embedded sections） - ACTH antibody （ab74976）Image from Zhang Z et al, J Biol Chem. 2010 Nov 5;285（45）:34718-28. Epub 2010 Aug 31, Fig 4. DOI 10.1074/jbc.M110.126441
  ab74976 staining ACTH in P0 Pitx2-Cre/Dicer1 mutant mice pituitary tissue by Immunohistochemistry （Formalin/PFA-fixed paraffin-embedded sections）.
  
  Samples were fixed in 4% paraformaldehyde, dehydrated, ａnd embedded in paraffin wax. Sections were cut （7 µm） ａnd stained with H&E. Immunohistochemistry was done on 7-µm paraffin sections stained by an indirect immunoperoxidase method. Peroxidase activity was visualized with AEC stain kit. ab74976 diluted 1/200. Secondary antibodies conjugated with biotin were used at 1/150 dilution.

References for Anti-ACTH antibody （ab74976）